Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1112713..1113440 | Replicon | chromosome |
Accession | NZ_CP101615 | ||
Organism | Escherichia coli strain DC71 |
Toxin (Protein)
Gene name | higB | Uniprot ID | J7Q991 |
Locus tag | NOF56_RS05425 | Protein ID | WP_000547564.1 |
Coordinates | 1112713..1113024 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NOF56_RS05430 | Protein ID | WP_000126294.1 |
Coordinates | 1113021..1113440 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOF56_RS05395 (1107855) | 1107855..1109564 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
NOF56_RS05400 (1109574) | 1109574..1110116 | + | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
NOF56_RS05405 (1110116) | 1110116..1110883 | + | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
NOF56_RS05410 (1110880) | 1110880..1111290 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
NOF56_RS05415 (1111283) | 1111283..1111753 | + | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
NOF56_RS05420 (1111778) | 1111778..1112539 | + | 762 | WP_001026446.1 | hypothetical protein | - |
NOF56_RS05425 (1112713) | 1112713..1113024 | + | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NOF56_RS05430 (1113021) | 1113021..1113440 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
NOF56_RS05435 (1113554) | 1113554..1114978 | - | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
NOF56_RS05440 (1114987) | 1114987..1116444 | - | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
NOF56_RS05445 (1116704) | 1116704..1117714 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
NOF56_RS05450 (1117863) | 1117863..1118390 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T252386 WP_000547564.1 NZ_CP101615:1112713-1113024 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT252386 WP_000126294.1 NZ_CP101615:1113021-1113440 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|