Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 22643..23300 | Replicon | plasmid pA84-2 |
| Accession | NZ_CP101597 | ||
| Organism | Cronobacter dublinensis strain CFSA A84 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NNQ27_RS22680 | Protein ID | WP_275886456.1 |
| Coordinates | 22929..23300 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NNQ27_RS22675 | Protein ID | WP_105693805.1 |
| Coordinates | 22643..22942 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNQ27_RS22655 (NNQ27_22655) | 18256..19188 | - | 933 | WP_275886479.1 | hypothetical protein | - |
| NNQ27_RS22660 (NNQ27_22660) | 21185..21457 | + | 273 | WP_275886453.1 | hypothetical protein | - |
| NNQ27_RS22665 (NNQ27_22665) | 21481..21750 | + | 270 | WP_275886454.1 | hypothetical protein | - |
| NNQ27_RS22670 (NNQ27_22670) | 21796..22020 | - | 225 | WP_275886455.1 | hypothetical protein | - |
| NNQ27_RS22675 (NNQ27_22675) | 22643..22942 | - | 300 | WP_105693805.1 | XRE family transcriptional regulator | Antitoxin |
| NNQ27_RS22680 (NNQ27_22680) | 22929..23300 | - | 372 | WP_275886456.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NNQ27_RS22685 (NNQ27_22685) | 23475..23736 | + | 262 | Protein_25 | hypothetical protein | - |
| NNQ27_RS22690 (NNQ27_22690) | 24953..25756 | - | 804 | WP_105648991.1 | DUF4225 domain-containing protein | - |
| NNQ27_RS22695 (NNQ27_22695) | 26156..26488 | + | 333 | WP_275886457.1 | hypothetical protein | - |
| NNQ27_RS22700 (NNQ27_22700) | 27294..27965 | + | 672 | WP_175613492.1 | hypothetical protein | - |
| NNQ27_RS22705 (NNQ27_22705) | 27967..28263 | + | 297 | WP_275886458.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..38910 | 38910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 14100.88 Da Isoelectric Point: 4.4512
>T252372 WP_275886456.1 NZ_CP101597:c23300-22929 [Cronobacter dublinensis]
MAWEIETRILFDTWFEEQEEDVQEEILAYFEILEGEGPNLGRPHVDSVNGSDYTNMKELRVQVGGHPYRLFFAFDPARKA
IVLCGGNKKGLVEKDFYKKMIKIADAEYASHLKSPEVKEDGDA
MAWEIETRILFDTWFEEQEEDVQEEILAYFEILEGEGPNLGRPHVDSVNGSDYTNMKELRVQVGGHPYRLFFAFDPARKA
IVLCGGNKKGLVEKDFYKKMIKIADAEYASHLKSPEVKEDGDA
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|