Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 2844079..2844724 | Replicon | chromosome |
| Accession | NZ_CP101591 | ||
| Organism | Cronobacter dublinensis strain CFSA A14 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | NMY27_RS13670 | Protein ID | WP_007750250.1 |
| Coordinates | 2844362..2844724 (-) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMY27_RS13665 | Protein ID | WP_007750247.1 |
| Coordinates | 2844079..2844375 (-) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY27_RS13655 (NMY27_13645) | 2841737..2842585 | - | 849 | WP_038887202.1 | DNA-3-methyladenine glycosylase 2 | - |
| NMY27_RS13660 (NMY27_13650) | 2842721..2844073 | + | 1353 | WP_105632043.1 | molecular chaperone | - |
| NMY27_RS13665 (NMY27_13655) | 2844079..2844375 | - | 297 | WP_007750247.1 | XRE family transcriptional regulator | Antitoxin |
| NMY27_RS13670 (NMY27_13660) | 2844362..2844724 | - | 363 | WP_007750250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMY27_RS13675 (NMY27_13665) | 2844954..2846195 | + | 1242 | WP_275875806.1 | MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit | - |
| NMY27_RS13680 (NMY27_13670) | 2846195..2849317 | + | 3123 | WP_275875807.1 | MdtB/MuxB family multidrug efflux RND transporter permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 14023.13 Da Isoelectric Point: 9.8453
>T252353 WP_007750250.1 NZ_CP101591:c2844724-2844362 [Cronobacter dublinensis]
MTWTVIFTPRFYEWYQQQPEGLQDRIAALLWNLRHSGPLVGRPLVDTIKGSQIPNLKELRVQYGGSPWRVFFAFDPTRQA
VVLCAGNKRGHKDFYKTLIRQAEEAFFLHLQIMESKNENA
MTWTVIFTPRFYEWYQQQPEGLQDRIAALLWNLRHSGPLVGRPLVDTIKGSQIPNLKELRVQYGGSPWRVFFAFDPTRQA
VVLCAGNKRGHKDFYKTLIRQAEEAFFLHLQIMESKNENA
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|