Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 103187..103440 | Replicon | plasmid p29_2 |
| Accession | NZ_CP101569 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP29 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NMY30_RS28935 | Protein ID | WP_001312851.1 |
| Coordinates | 103187..103336 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 103381..103440 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY30_RS28900 (98546) | 98546..98961 | - | 416 | Protein_128 | IS1 family transposase | - |
| NMY30_RS28905 (99210) | 99210..99611 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NMY30_RS28910 (99544) | 99544..99801 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NMY30_RS28915 (99894) | 99894..100547 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NMY30_RS28920 (101486) | 101486..102343 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NMY30_RS28925 (102362) | 102362..102540 | - | 179 | Protein_133 | protein CopA/IncA | - |
| NMY30_RS28930 (102655) | 102655..102903 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NMY30_RS28935 (103187) | 103187..103336 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (103381) | 103381..103440 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (103381) | 103381..103440 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (103381) | 103381..103440 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (103381) | 103381..103440 | + | 60 | NuclAT_1 | - | Antitoxin |
| NMY30_RS28940 (103641) | 103641..103973 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| NMY30_RS28945 (104035) | 104035..104634 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NMY30_RS28950 (105020) | 105020..105220 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| NMY30_RS28955 (105352) | 105352..105912 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NMY30_RS28960 (105967) | 105967..106713 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NMY30_RS28965 (106733) | 106733..106933 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| NMY30_RS28970 (106958) | 106958..107662 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NMY30_RS28975 (107715) | 107715..107780 | + | 66 | Protein_143 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaSHV-12 / blaKPC-2 / rmtB / fosA3 / blaCTX-M-65 / catA2 | - | 1..138059 | 138059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252340 WP_001312851.1 NZ_CP101569:c103336-103187 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252340 NZ_CP101569:103381-103440 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
