Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 171422..172149 | Replicon | plasmid p29_1 |
Accession | NZ_CP101568 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP29 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
Locus tag | NMY30_RS27815 | Protein ID | WP_004118600.1 |
Coordinates | 171838..172149 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | V0AHC4 |
Locus tag | NMY30_RS27810 | Protein ID | WP_000990392.1 |
Coordinates | 171422..171841 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY30_RS27775 (NMY30_27755) | 167109..167471 | - | 363 | WP_020324593.1 | arsenite efflux transporter metallochaperone ArsD | - |
NMY30_RS27780 (NMY30_27760) | 167519..167872 | - | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
NMY30_RS27785 (NMY30_27765) | 168165..168305 | + | 141 | WP_004118614.1 | hypothetical protein | - |
NMY30_RS27790 (NMY30_27770) | 168473..168781 | + | 309 | WP_020324596.1 | Ref family recombination enhancement nuclease | - |
NMY30_RS27795 (NMY30_27775) | 169205..169864 | + | 660 | WP_000078540.1 | hypothetical protein | - |
NMY30_RS27800 (NMY30_27780) | 169861..170190 | + | 330 | WP_004118613.1 | hypothetical protein | - |
NMY30_RS27805 (NMY30_27785) | 170183..171385 | + | 1203 | WP_003031541.1 | hypothetical protein | - |
NMY30_RS27810 (NMY30_27790) | 171422..171841 | - | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
NMY30_RS27815 (NMY30_27795) | 171838..172149 | - | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NMY30_RS27820 (NMY30_27800) | 172360..172740 | + | 381 | Protein_197 | gluconate permease | - |
NMY30_RS27825 (NMY30_27805) | 172790..173485 | - | 696 | WP_004118595.1 | lactate utilization protein C | - |
NMY30_RS27830 (NMY30_27810) | 173478..174905 | - | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NMY30_RS27835 (NMY30_27815) | 174916..175635 | - | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-14 / aac(3)-IId / blaLAP-2 / qnrS1 / tet(D) / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B | - | 1..258415 | 258415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T252335 WP_004118600.1 NZ_CP101568:c172149-171838 [Klebsiella pneumoniae subsp. pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT252335 WP_000990392.1 NZ_CP101568:c171841-171422 [Klebsiella pneumoniae subsp. pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AHC4 |