Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 171422..172149 Replicon plasmid p29_1
Accession NZ_CP101568
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP29

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag NMY30_RS27815 Protein ID WP_004118600.1
Coordinates 171838..172149 (-) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag NMY30_RS27810 Protein ID WP_000990392.1
Coordinates 171422..171841 (-) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY30_RS27775 (NMY30_27755) 167109..167471 - 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -
NMY30_RS27780 (NMY30_27760) 167519..167872 - 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NMY30_RS27785 (NMY30_27765) 168165..168305 + 141 WP_004118614.1 hypothetical protein -
NMY30_RS27790 (NMY30_27770) 168473..168781 + 309 WP_020324596.1 Ref family recombination enhancement nuclease -
NMY30_RS27795 (NMY30_27775) 169205..169864 + 660 WP_000078540.1 hypothetical protein -
NMY30_RS27800 (NMY30_27780) 169861..170190 + 330 WP_004118613.1 hypothetical protein -
NMY30_RS27805 (NMY30_27785) 170183..171385 + 1203 WP_003031541.1 hypothetical protein -
NMY30_RS27810 (NMY30_27790) 171422..171841 - 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
NMY30_RS27815 (NMY30_27795) 171838..172149 - 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
NMY30_RS27820 (NMY30_27800) 172360..172740 + 381 Protein_197 gluconate permease -
NMY30_RS27825 (NMY30_27805) 172790..173485 - 696 WP_004118595.1 lactate utilization protein C -
NMY30_RS27830 (NMY30_27810) 173478..174905 - 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
NMY30_RS27835 (NMY30_27815) 174916..175635 - 720 WP_001102107.1 (Fe-S)-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-14 / aac(3)-IId / blaLAP-2 / qnrS1 / tet(D) / sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B - 1..258415 258415


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T252335 WP_004118600.1 NZ_CP101568:c172149-171838 [Klebsiella pneumoniae subsp. pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT252335 WP_000990392.1 NZ_CP101568:c171841-171422 [Klebsiella pneumoniae subsp. pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References