Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328933..329519 Replicon chromosome
Accession NZ_CP101567
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP29

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NMY30_RS01530 Protein ID WP_002920800.1
Coordinates 329151..329519 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NMY30_RS01525 Protein ID WP_002920802.1
Coordinates 328933..329154 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY30_RS01505 (NMY30_01505) 325090..326016 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMY30_RS01510 (NMY30_01510) 326013..327290 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NMY30_RS01515 (NMY30_01515) 327287..328054 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMY30_RS01520 (NMY30_01520) 328056..328769 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMY30_RS01525 (NMY30_01525) 328933..329154 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMY30_RS01530 (NMY30_01530) 329151..329519 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMY30_RS01535 (NMY30_01535) 329792..331108 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMY30_RS01540 (NMY30_01540) 331215..332102 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMY30_RS01545 (NMY30_01545) 332099..332944 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMY30_RS01550 (NMY30_01550) 332946..334016 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 326013..334753 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T252321 WP_002920800.1 NZ_CP101567:329151-329519 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT252321 WP_002920802.1 NZ_CP101567:328933-329154 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References