Detailed information of TA system TA252318

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 100677..100946
• Replicon: plasmid p65_1
• Accession: NZ_CP101564
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain KP65

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NMY31_RS27515
• Protein ID: WP_001372321.1
• Coordinates: 100821..100946 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	100677..100742 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NMY31_RS27485	96387..96914	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NMY31_RS27490	96972..97205	+	234	WP_000006003.1	DUF905 family protein	-
NMY31_RS27495	97266..99289	+	2024	Protein_136	ParB/RepB/Spo0J family partition protein	-
NMY31_RS27500	99358..99792	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NMY31_RS27505	99789..100508	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	100520..100744	+	225	NuclAT_0	-	-
-	100520..100744	+	225	NuclAT_0	-	-
-	100520..100744	+	225	NuclAT_0	-	-
-	100520..100744	+	225	NuclAT_0	-	-
-	100677..100742	-	66	-	-	Antitoxin
NMY31_RS27510	100730..100879	+	150	Protein_139	plasmid maintenance protein Mok	-
NMY31_RS27515	100821..100946	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NMY31_RS27520	101265..101561	-	297	Protein_141	hypothetical protein	-
NMY31_RS27525	101912..102616	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NMY31_RS27530	102679..103074	+	396	Protein_143	ATP-dependent endonuclease	-
NMY31_RS27535	103059..104081	+	1023	WP_000361404.1	helicase UvrD	-
NMY31_RS27540	104337..105034	+	698	WP_223174630.1	IS1 family transposase	-
NMY31_RS27545	105063..105335	+	273	Protein_146	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12	-	1..126958	126958

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252318 WP_001372321.1 NZ_CP101564:100821-100946 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT252318 NZ_CP101564:c100742-100677 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin