Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 62437..62690 | Replicon | plasmid p65_1 |
| Accession | NZ_CP101564 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP65 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NMY31_RS27255 | Protein ID | WP_001312851.1 |
| Coordinates | 62541..62690 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 62437..62496 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY31_RS27215 (58097) | 58097..58162 | - | 66 | Protein_80 | helix-turn-helix domain-containing protein | - |
| NMY31_RS27220 (58215) | 58215..58919 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NMY31_RS27225 (58944) | 58944..59144 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NMY31_RS27230 (59164) | 59164..59910 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NMY31_RS27235 (59965) | 59965..60525 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NMY31_RS27240 (60657) | 60657..60857 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NMY31_RS27245 (61243) | 61243..61842 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NMY31_RS27250 (61904) | 61904..62236 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (62437) | 62437..62496 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (62437) | 62437..62496 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (62437) | 62437..62496 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (62437) | 62437..62496 | - | 60 | NuclAT_1 | - | Antitoxin |
| NMY31_RS27255 (62541) | 62541..62690 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NMY31_RS27260 (62974) | 62974..63222 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NMY31_RS27265 (63337) | 63337..63515 | + | 179 | Protein_90 | protein CopA/IncA | - |
| NMY31_RS27270 (63534) | 63534..64391 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NMY31_RS27275 (65330) | 65330..65983 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NMY31_RS27280 (66076) | 66076..66333 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NMY31_RS27285 (66266) | 66266..66667 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NMY31_RS27290 (66916) | 66916..67331 | + | 416 | Protein_95 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..126958 | 126958 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252314 WP_001312851.1 NZ_CP101564:62541-62690 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252314 NZ_CP101564:c62496-62437 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
