Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2496..2760 Replicon plasmid p72_2
Accession NZ_CP101556
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NMY33_RS28195 Protein ID WP_001387489.1
Coordinates 2496..2648 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 2700..2760 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS28170 (1) 1..663 + 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
NMY33_RS28175 (735) 735..944 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
NMY33_RS28180 (1336) 1336..1512 + 177 WP_001054900.1 hypothetical protein -
NMY33_RS28185 (1577) 1577..1873 - 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NMY33_RS28190 (2173) 2173..2424 + 252 WP_001291964.1 hypothetical protein -
NMY33_RS28195 (2496) 2496..2648 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (2700) 2700..2760 + 61 NuclAT_0 - Antitoxin
- (2700) 2700..2760 + 61 NuclAT_0 - Antitoxin
- (2700) 2700..2760 + 61 NuclAT_0 - Antitoxin
- (2700) 2700..2760 + 61 NuclAT_0 - Antitoxin
NMY33_RS28200 (2969) 2969..4054 + 1086 WP_000080543.1 protein finQ -
- (4124) 4124..4181 + 58 NuclAT_1 - -
- (4124) 4124..4181 + 58 NuclAT_1 - -
- (4124) 4124..4181 + 58 NuclAT_1 - -
- (4124) 4124..4181 + 58 NuclAT_1 - -
NMY33_RS28205 (4361) 4361..5569 + 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
NMY33_RS28210 (5588) 5588..6658 + 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..87511 87511


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T252293 WP_001387489.1 NZ_CP101556:c2648-2496 [Klebsiella pneumoniae subsp. pneumoniae]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT252293 NZ_CP101556:2700-2760 [Klebsiella pneumoniae subsp. pneumoniae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References