Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 782598..783373 | Replicon | chromosome |
Accession | NZ_CP101554 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP72 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | A0A1Q4Q548 |
Locus tag | NMY33_RS03920 | Protein ID | WP_004150910.1 |
Coordinates | 782888..783373 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | NMY33_RS03915 | Protein ID | WP_004150912.1 |
Coordinates | 782598..782891 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMY33_RS03895 (NMY33_03895) | 777806..778408 | - | 603 | WP_002916735.1 | short chain dehydrogenase | - |
NMY33_RS03900 (NMY33_03900) | 778506..779417 | + | 912 | WP_004188550.1 | LysR family transcriptional regulator | - |
NMY33_RS03905 (NMY33_03905) | 779418..780566 | - | 1149 | WP_004150915.1 | PLP-dependent aspartate aminotransferase family protein | - |
NMY33_RS03910 (NMY33_03910) | 780577..781953 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
NMY33_RS03915 (NMY33_03915) | 782598..782891 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
NMY33_RS03920 (NMY33_03920) | 782888..783373 | + | 486 | WP_004150910.1 | GNAT family N-acetyltransferase | Toxin |
NMY33_RS03925 (NMY33_03925) | 784077..784670 | + | 594 | WP_004188553.1 | hypothetical protein | - |
NMY33_RS03930 (NMY33_03930) | 784767..784983 | + | 217 | Protein_771 | transposase | - |
NMY33_RS03935 (NMY33_03935) | 785589..786461 | + | 873 | WP_004188557.1 | ParA family protein | - |
NMY33_RS03940 (NMY33_03940) | 786461..786844 | + | 384 | WP_004150906.1 | hypothetical protein | - |
NMY33_RS03945 (NMY33_03945) | 786837..788204 | + | 1368 | WP_004150905.1 | SPI-7-type island replicative DNA helicase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 784767..784919 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17551.59 Da Isoelectric Point: 8.8818
>T252279 WP_004150910.1 NZ_CP101554:782888-783373 [Klebsiella pneumoniae subsp. pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPAPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDPMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q4Q548 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |