Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 332728..333314 Replicon chromosome
Accession NZ_CP101554
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP72

Toxin (Protein)


Gene name doc Uniprot ID A0A483YV82
Locus tag NMY33_RS01550 Protein ID WP_019725145.1
Coordinates 332946..333314 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A483YZZ9
Locus tag NMY33_RS01545 Protein ID WP_019725146.1
Coordinates 332728..332949 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY33_RS01525 (NMY33_01525) 328885..329811 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMY33_RS01530 (NMY33_01530) 329808..331085 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
NMY33_RS01535 (NMY33_01535) 331082..331849 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMY33_RS01540 (NMY33_01540) 331851..332564 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMY33_RS01545 (NMY33_01545) 332728..332949 + 222 WP_019725146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMY33_RS01550 (NMY33_01550) 332946..333314 + 369 WP_019725145.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMY33_RS01555 (NMY33_01555) 333586..334902 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMY33_RS01560 (NMY33_01560) 335009..335896 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMY33_RS01565 (NMY33_01565) 335893..336738 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMY33_RS01570 (NMY33_01570) 336740..337810 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 329808..338547 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13542.89 Da        Isoelectric Point: 8.6410

>T252276 WP_019725145.1 NZ_CP101554:332946-333314 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTSGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFIKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT252276 WP_019725146.1 NZ_CP101554:332728-332949 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A483YV82

Antitoxin

Source ID Structure
AlphaFold DB A0A483YZZ9

References