Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 178667..179394 Replicon plasmid p82_1
Accession NZ_CP101547
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP82

Toxin (Protein)


Gene name higB Uniprot ID A0A5Q9LNL2
Locus tag NMY34_RS26885 Protein ID WP_004118600.1
Coordinates 178667..178978 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID V0AHC4
Locus tag NMY34_RS26890 Protein ID WP_000990392.1
Coordinates 178975..179394 (+) Length 140 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY34_RS26865 (NMY34_26845) 175181..175900 + 720 WP_001102107.1 (Fe-S)-binding protein -
NMY34_RS26870 (NMY34_26850) 175911..177338 + 1428 WP_000023895.1 LutB/LldF family L-lactate oxidation iron-sulfur protein -
NMY34_RS26875 (NMY34_26855) 177331..178026 + 696 WP_004118595.1 lactate utilization protein C -
NMY34_RS26880 (NMY34_26860) 178076..178456 - 381 Protein_195 gluconate permease -
NMY34_RS26885 (NMY34_26865) 178667..178978 + 312 WP_004118600.1 type II toxin-antitoxin system HigB family toxin Toxin
NMY34_RS26890 (NMY34_26870) 178975..179394 + 420 WP_000990392.1 helix-turn-helix domain-containing protein Antitoxin
NMY34_RS26895 (NMY34_26875) 179431..180633 - 1203 WP_003031541.1 hypothetical protein -
NMY34_RS26900 (NMY34_26880) 180626..180955 - 330 WP_004118613.1 hypothetical protein -
NMY34_RS26905 (NMY34_26885) 180952..181611 - 660 WP_000078540.1 hypothetical protein -
NMY34_RS26910 (NMY34_26890) 182035..182391 - 357 WP_077253206.1 Ref family recombination enhancement nuclease -
NMY34_RS26915 (NMY34_26895) 182511..182651 - 141 WP_004118614.1 hypothetical protein -
NMY34_RS26920 (NMY34_26900) 182944..183297 + 354 WP_001114073.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NMY34_RS26925 (NMY34_26905) 183345..183707 + 363 WP_020324593.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-14 / aac(3)-IId / blaLAP-2 / qnrS1 / sul1 / qacE / dfrA1 / tet(A) - 1..255261 255261


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(20-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(83-136)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12386.14 Da        Isoelectric Point: 10.0935

>T252274 WP_004118600.1 NZ_CP101547:178667-178978 [Klebsiella pneumoniae subsp. pneumoniae]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE

Download         Length: 312 bp

Antitoxin


Download         Length: 140 a.a.        Molecular weight: 15534.71 Da        Isoelectric Point: 4.4702

>AT252274 WP_000990392.1 NZ_CP101547:178975-179394 [Klebsiella pneumoniae subsp. pneumoniae]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA

Download         Length: 420 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q9LNL2

Antitoxin

Source ID Structure
AlphaFold DB V0AHC4

References