Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 309832..310418 Replicon chromosome
Accession NZ_CP101546
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP82

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NMY34_RS01465 Protein ID WP_002920800.1
Coordinates 310050..310418 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NMY34_RS01460 Protein ID WP_002920802.1
Coordinates 309832..310053 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY34_RS01440 (NMY34_01440) 305989..306915 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMY34_RS01445 (NMY34_01445) 306912..308189 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NMY34_RS01450 (NMY34_01450) 308186..308953 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMY34_RS01455 (NMY34_01455) 308955..309668 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMY34_RS01460 (NMY34_01460) 309832..310053 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMY34_RS01465 (NMY34_01465) 310050..310418 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMY34_RS01470 (NMY34_01470) 310691..312007 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMY34_RS01475 (NMY34_01475) 312114..313001 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMY34_RS01480 (NMY34_01480) 312998..313843 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMY34_RS01485 (NMY34_01485) 313845..314915 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 306912..315652 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T252260 WP_002920800.1 NZ_CP101546:310050-310418 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT252260 WP_002920802.1 NZ_CP101546:309832-310053 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References