Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 92324..92593 | Replicon | plasmid p21_1 |
| Accession | NZ_CP101543 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | NMY29_RS27660 | Protein ID | WP_001372321.1 |
| Coordinates | 92468..92593 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 92324..92389 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY29_RS27630 | 88034..88561 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| NMY29_RS27635 | 88619..88852 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| NMY29_RS27640 | 88913..90936 | + | 2024 | Protein_123 | ParB/RepB/Spo0J family partition protein | - |
| NMY29_RS27645 | 91005..91439 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| NMY29_RS27650 | 91436..92155 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 92167..92391 | + | 225 | NuclAT_0 | - | - |
| - | 92167..92391 | + | 225 | NuclAT_0 | - | - |
| - | 92167..92391 | + | 225 | NuclAT_0 | - | - |
| - | 92167..92391 | + | 225 | NuclAT_0 | - | - |
| - | 92324..92389 | - | 66 | - | - | Antitoxin |
| NMY29_RS27655 | 92377..92526 | + | 150 | Protein_126 | plasmid maintenance protein Mok | - |
| NMY29_RS27660 | 92468..92593 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| NMY29_RS27665 | 92912..93208 | - | 297 | Protein_128 | hypothetical protein | - |
| NMY29_RS27670 | 93559..94263 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NMY29_RS27675 | 94326..94721 | + | 396 | Protein_130 | ATP-dependent endonuclease | - |
| NMY29_RS27680 | 94706..95728 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| NMY29_RS27685 | 95984..96681 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| NMY29_RS27690 | 96710..96982 | + | 273 | Protein_133 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..129998 | 129998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T252255 WP_001372321.1 NZ_CP101543:92468-92593 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT252255 NZ_CP101543:c92389-92324 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|