Detailed information of TA system TA252255

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 92324..92593
• Replicon: plasmid p21_1
• Accession: NZ_CP101543
• Organism: Klebsiella pneumoniae subsp. pneumoniae strain KP21

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NMY29_RS27660
• Protein ID: WP_001372321.1
• Coordinates: 92468..92593 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	92324..92389 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NMY29_RS27630	88034..88561	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
NMY29_RS27635	88619..88852	+	234	WP_000006003.1	DUF905 family protein	-
NMY29_RS27640	88913..90936	+	2024	Protein_123	ParB/RepB/Spo0J family partition protein	-
NMY29_RS27645	91005..91439	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NMY29_RS27650	91436..92155	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	92167..92391	+	225	NuclAT_0	-	-
-	92167..92391	+	225	NuclAT_0	-	-
-	92167..92391	+	225	NuclAT_0	-	-
-	92167..92391	+	225	NuclAT_0	-	-
-	92324..92389	-	66	-	-	Antitoxin
NMY29_RS27655	92377..92526	+	150	Protein_126	plasmid maintenance protein Mok	-
NMY29_RS27660	92468..92593	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NMY29_RS27665	92912..93208	-	297	Protein_128	hypothetical protein	-
NMY29_RS27670	93559..94263	-	705	WP_001067855.1	IS6-like element IS26 family transposase	-
NMY29_RS27675	94326..94721	+	396	Protein_130	ATP-dependent endonuclease	-
NMY29_RS27680	94706..95728	+	1023	WP_000361404.1	helicase UvrD	-
NMY29_RS27685	95984..96681	+	698	WP_223174630.1	IS1 family transposase	-
NMY29_RS27690	96710..96982	+	273	Protein_133	transposase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12	-	1..129998	129998

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252255 WP_001372321.1 NZ_CP101543:92468-92593 [Klebsiella pneumoniae subsp. pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT252255 NZ_CP101543:c92389-92324 [Klebsiella pneumoniae subsp. pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin