Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54083..54336 | Replicon | plasmid p21_1 |
| Accession | NZ_CP101543 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain KP21 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | NMY29_RS27400 | Protein ID | WP_001312851.1 |
| Coordinates | 54187..54336 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54083..54142 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMY29_RS27360 (49743) | 49743..49808 | - | 66 | Protein_67 | helix-turn-helix domain-containing protein | - |
| NMY29_RS27365 (49861) | 49861..50565 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| NMY29_RS27370 (50590) | 50590..50790 | + | 201 | WP_072354025.1 | hypothetical protein | - |
| NMY29_RS27375 (50810) | 50810..51556 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| NMY29_RS27380 (51611) | 51611..52171 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| NMY29_RS27385 (52303) | 52303..52503 | + | 201 | WP_015059022.1 | hypothetical protein | - |
| NMY29_RS27390 (52889) | 52889..53488 | + | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| NMY29_RS27395 (53550) | 53550..53882 | + | 333 | WP_152916585.1 | hypothetical protein | - |
| - (54083) | 54083..54142 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (54083) | 54083..54142 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (54083) | 54083..54142 | - | 60 | NuclAT_1 | - | Antitoxin |
| - (54083) | 54083..54142 | - | 60 | NuclAT_1 | - | Antitoxin |
| NMY29_RS27400 (54187) | 54187..54336 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| NMY29_RS27405 (54620) | 54620..54868 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| NMY29_RS27410 (54983) | 54983..55161 | + | 179 | Protein_77 | protein CopA/IncA | - |
| NMY29_RS27415 (55180) | 55180..56037 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| NMY29_RS27420 (56976) | 56976..57629 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| NMY29_RS27425 (57722) | 57722..57979 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| NMY29_RS27430 (57912) | 57912..58313 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| NMY29_RS27435 (58562) | 58562..58977 | + | 416 | Protein_82 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | catA2 / blaCTX-M-65 / fosA3 / blaTEM-1B / rmtB / blaKPC-2 / blaSHV-12 | - | 1..129998 | 129998 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T252251 WP_001312851.1 NZ_CP101543:54187-54336 [Klebsiella pneumoniae subsp. pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT252251 NZ_CP101543:c54142-54083 [Klebsiella pneumoniae subsp. pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
