Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 329760..330346 Replicon chromosome
Accession NZ_CP101542
Organism Klebsiella pneumoniae subsp. pneumoniae strain KP21

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag NMY29_RS01535 Protein ID WP_002920800.1
Coordinates 329978..330346 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A0H3GZM4
Locus tag NMY29_RS01530 Protein ID WP_002920802.1
Coordinates 329760..329981 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMY29_RS01510 (NMY29_01510) 325917..326843 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NMY29_RS01515 (NMY29_01515) 326840..328117 + 1278 WP_002920806.1 branched chain amino acid ABC transporter permease LivM -
NMY29_RS01520 (NMY29_01520) 328114..328881 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NMY29_RS01525 (NMY29_01525) 328883..329596 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NMY29_RS01530 (NMY29_01530) 329760..329981 + 222 WP_002920802.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NMY29_RS01535 (NMY29_01535) 329978..330346 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NMY29_RS01540 (NMY29_01540) 330619..331935 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NMY29_RS01545 (NMY29_01545) 332042..332929 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NMY29_RS01550 (NMY29_01550) 332926..333771 + 846 WP_002920789.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NMY29_RS01555 (NMY29_01555) 333773..334843 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 326840..335580 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T252237 WP_002920800.1 NZ_CP101542:329978-330346 [Klebsiella pneumoniae subsp. pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8181.18 Da        Isoelectric Point: 4.7769

>AT252237 WP_002920802.1 NZ_CP101542:329760-329981 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZM4

References