Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5341619..5342214 | Replicon | chromosome |
Accession | NZ_CP101540 | ||
Organism | Pseudomonas aeruginosa strain D-2 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | NNL25_RS24890 | Protein ID | WP_003113526.1 |
Coordinates | 5341936..5342214 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NNL25_RS24885 | Protein ID | WP_003099268.1 |
Coordinates | 5341619..5341924 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL25_RS24865 (NNL25_24835) | 5337104..5337439 | + | 336 | WP_255866659.1 | hypothetical protein | - |
NNL25_RS24870 (NNL25_24840) | 5337971..5339737 | - | 1767 | WP_023087829.1 | anti-phage dCTP deaminase | - |
NNL25_RS24875 (NNL25_24845) | 5339994..5340656 | - | 663 | WP_023087830.1 | restriction endonuclease | - |
NNL25_RS24880 (NNL25_24850) | 5340880..5341293 | - | 414 | WP_049231965.1 | hypothetical protein | - |
NNL25_RS24885 (NNL25_24855) | 5341619..5341924 | - | 306 | WP_003099268.1 | HigA family addiction module antitoxin | Antitoxin |
NNL25_RS24890 (NNL25_24860) | 5341936..5342214 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NNL25_RS24895 (NNL25_24865) | 5342267..5342395 | - | 129 | Protein_4918 | integrase | - |
NNL25_RS24900 (NNL25_24870) | 5342543..5344771 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
NNL25_RS24905 (NNL25_24875) | 5344841..5345488 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
NNL25_RS24910 (NNL25_24880) | 5345550..5346788 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T252236 WP_003113526.1 NZ_CP101540:c5342214-5341936 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|