Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 2753580..2754102 | Replicon | chromosome |
Accession | NZ_CP101538 | ||
Organism | Lacticaseibacillus rhamnosus strain HN067 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | C2JUK2 |
Locus tag | NNM43_RS12855 | Protein ID | WP_005687756.1 |
Coordinates | 2753842..2754102 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | C2JUK3 |
Locus tag | NNM43_RS12850 | Protein ID | WP_005687754.1 |
Coordinates | 2753580..2753849 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNM43_RS12830 (NNM43_12870) | 2749167..2749736 | - | 570 | WP_005687747.1 | PTS glucitol/sorbitol transporter subunit IIC | - |
NNM43_RS12835 (NNM43_12875) | 2749749..2750258 | - | 510 | WP_005687749.1 | transcriptional regulator GutM | - |
NNM43_RS12840 (NNM43_12880) | 2750259..2752127 | - | 1869 | WP_005687750.1 | helix-turn-helix domain-containing protein | - |
NNM43_RS12845 (NNM43_12885) | 2752154..2752954 | - | 801 | WP_005687752.1 | SDR family oxidoreductase | - |
NNM43_RS12850 (NNM43_12890) | 2753580..2753849 | + | 270 | WP_005687754.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NNM43_RS12855 (NNM43_12895) | 2753842..2754102 | + | 261 | WP_005687756.1 | Txe/YoeB family addiction module toxin | Toxin |
NNM43_RS12860 (NNM43_12900) | 2754313..2755041 | - | 729 | WP_005687757.1 | L-ribulose-5-phosphate 4-epimerase | - |
NNM43_RS12865 (NNM43_12905) | 2755238..2756059 | + | 822 | WP_005687759.1 | Cof-type HAD-IIB family hydrolase | - |
NNM43_RS12870 (NNM43_12910) | 2756126..2757013 | - | 888 | WP_005687761.1 | L-ribulose-5-phosphate 3-epimerase | - |
NNM43_RS12875 (NNM43_12915) | 2757197..2757976 | - | 780 | WP_005690765.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
NNM43_RS12880 (NNM43_12920) | 2758044..2758685 | - | 642 | WP_005687764.1 | 3-keto-L-gulonate-6-phosphate decarboxylase UlaD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10485.91 Da Isoelectric Point: 9.6577
>T252228 WP_005687756.1 NZ_CP101538:2753842-2754102 [Lacticaseibacillus rhamnosus]
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
MIKTWTDDAWADYMYWHDQNDKRTIKRINQLIQAIDRDPYKGIGKPEPLRYALTGKWSRRIDQENRIIYSIEKNHINIFA
CRTHYS
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N526 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A249N594 |