Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 140601..140854 Replicon plasmid pKPC-2_FZKP4523
Accession NZ_CP101534
Organism Klebsiella pneumoniae strain FZKP4523

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag NNL33_RS27885 Protein ID WP_001312851.1
Coordinates 140705..140854 (+) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 140601..140660 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NNL33_RS27845 (136261) 136261..136326 - 66 Protein_187 helix-turn-helix domain-containing protein -
NNL33_RS27850 (136379) 136379..137083 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NNL33_RS27855 (137108) 137108..137308 + 201 WP_072354025.1 hypothetical protein -
NNL33_RS27860 (137328) 137328..138074 + 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
NNL33_RS27865 (138129) 138129..138689 + 561 WP_000139328.1 fertility inhibition protein FinO -
NNL33_RS27870 (138821) 138821..139021 + 201 WP_015059022.1 hypothetical protein -
NNL33_RS27875 (139407) 139407..140006 + 600 WP_032083981.1 PIN domain-containing protein -
NNL33_RS27880 (140068) 140068..140400 + 333 WP_152916585.1 hypothetical protein -
- (140601) 140601..140660 - 60 NuclAT_1 - Antitoxin
- (140601) 140601..140660 - 60 NuclAT_1 - Antitoxin
- (140601) 140601..140660 - 60 NuclAT_1 - Antitoxin
- (140601) 140601..140660 - 60 NuclAT_1 - Antitoxin
NNL33_RS27885 (140705) 140705..140854 + 150 WP_001312851.1 Hok/Gef family protein Toxin
NNL33_RS27890 (141138) 141138..141386 + 249 WP_000083837.1 replication regulatory protein RepA -
NNL33_RS27895 (141501) 141501..141685 + 185 Protein_197 protein CopA/IncA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid blaKPC-2 / blaCTX-M-65 / blaTEM-1B / rmtB - 1..141697 141697


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T252225 WP_001312851.1 NZ_CP101534:140705-140854 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT252225 NZ_CP101534:c140660-140601 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References