Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 901664..902316 | Replicon | chromosome |
Accession | NZ_CP101527 | ||
Organism | Alkalimarinus sediminis strain FA028 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | NNL22_RS04115 | Protein ID | WP_251810397.1 |
Coordinates | 901664..902005 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NNL22_RS04120 | Protein ID | WP_251810396.1 |
Coordinates | 902005..902316 (+) | Length | 104 a.a. |
Genomic Context
Location: 898152..898508 (357 bp)
Type: Others
Protein ID: WP_251810402.1
Type: Others
Protein ID: WP_251810402.1
Location: 898522..899226 (705 bp)
Type: Others
Protein ID: WP_251810401.1
Type: Others
Protein ID: WP_251810401.1
Location: 899287..900261 (975 bp)
Type: Others
Protein ID: WP_251810400.1
Type: Others
Protein ID: WP_251810400.1
Location: 900268..900948 (681 bp)
Type: Others
Protein ID: WP_251810399.1
Type: Others
Protein ID: WP_251810399.1
Location: 900984..901595 (612 bp)
Type: Others
Protein ID: WP_251810398.1
Type: Others
Protein ID: WP_251810398.1
Location: 901664..902005 (342 bp)
Type: Toxin
Protein ID: WP_251810397.1
Type: Toxin
Protein ID: WP_251810397.1
Location: 902005..902316 (312 bp)
Type: Antitoxin
Protein ID: WP_251810396.1
Type: Antitoxin
Protein ID: WP_251810396.1
Location: 897127..897492 (366 bp)
Type: Others
Protein ID: Protein_793
Type: Others
Protein ID: Protein_793
Location: 902366..904360 (1995 bp)
Type: Others
Protein ID: WP_251810395.1
Type: Others
Protein ID: WP_251810395.1
Location: 904585..906684 (2100 bp)
Type: Others
Protein ID: WP_275116340.1
Type: Others
Protein ID: WP_275116340.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NNL22_RS04080 (NNL22_04080) | 897127..897492 | - | 366 | Protein_793 | methionine-R-sulfoxide reductase | - |
NNL22_RS04090 (NNL22_04090) | 898152..898508 | + | 357 | WP_251810402.1 | rhodanese-like domain-containing protein | - |
NNL22_RS04095 (NNL22_04095) | 898522..899226 | + | 705 | WP_251810401.1 | DsbA family protein | - |
NNL22_RS04100 (NNL22_04100) | 899287..900261 | + | 975 | WP_251810400.1 | arsenosugar biosynthesis radical SAM protein ArsS | - |
NNL22_RS04105 (NNL22_04105) | 900268..900948 | + | 681 | WP_251810399.1 | TIGR04283 family arsenosugar biosynthesis glycosyltransferase | - |
NNL22_RS04110 (NNL22_04110) | 900984..901595 | + | 612 | WP_251810398.1 | TIGR04282 family arsenosugar biosynthesis glycosyltransferase | - |
NNL22_RS04115 (NNL22_04115) | 901664..902005 | + | 342 | WP_251810397.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NNL22_RS04120 (NNL22_04120) | 902005..902316 | + | 312 | WP_251810396.1 | transcriptional regulator | Antitoxin |
NNL22_RS04125 (NNL22_04125) | 902366..904360 | - | 1995 | WP_251810395.1 | hypothetical protein | - |
NNL22_RS18730 | 904585..906684 | - | 2100 | WP_275116340.1 | flagellin | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13586.60 Da Isoelectric Point: 10.4546
>T252204 WP_251810397.1 NZ_CP101527:901664-902005 [Alkalimarinus sediminis]
MKAVFVELPPFERVRKDYWDDNTFRNFQNEMLNNPFSGDVIKGTGGLRKVRFRDEKRRKGKRGGVRVIYYWWKEGAQFWL
FTIYGKDEVTDLTNAERKLLAELLRHEIQVRSL
MKAVFVELPPFERVRKDYWDDNTFRNFQNEMLNNPFSGDVIKGTGGLRKVRFRDEKRRKGKRGGVRVIYYWWKEGAQFWL
FTIYGKDEVTDLTNAERKLLAELLRHEIQVRSL
Download Length: 342 bp