Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 44107..44371 | Replicon | plasmid pHH194M-88K |
| Accession | NZ_CP101515 | ||
| Organism | Escherichia coli strain HH194M | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | A0A8H9BDR8 |
| Locus tag | MOO21_RS23600 | Protein ID | WP_023156060.1 |
| Coordinates | 44219..44371 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 44107..44164 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOO21_RS23585 (40149) | 40149..41219 | - | 1071 | WP_000151579.1 | IncI1-type conjugal transfer protein TrbB | - |
| MOO21_RS23590 (41238) | 41238..42446 | - | 1209 | WP_247193886.1 | IncI1-type conjugal transfer protein TrbA | - |
| MOO21_RS23595 (42664) | 42664..43617 | - | 954 | WP_021513958.1 | hypothetical protein | - |
| - (43811) | 43811..43866 | - | 56 | NuclAT_1 | - | - |
| - (43811) | 43811..43866 | - | 56 | NuclAT_1 | - | - |
| - (43811) | 43811..43866 | - | 56 | NuclAT_1 | - | - |
| - (43811) | 43811..43866 | - | 56 | NuclAT_1 | - | - |
| - (44107) | 44107..44164 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (44107) | 44107..44164 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (44107) | 44107..44164 | - | 58 | NuclAT_0 | - | Antitoxin |
| - (44107) | 44107..44164 | - | 58 | NuclAT_0 | - | Antitoxin |
| MOO21_RS23600 (44219) | 44219..44371 | + | 153 | WP_023156060.1 | Hok/Gef family protein | Toxin |
| MOO21_RS23605 (44443) | 44443..44694 | - | 252 | WP_001291965.1 | hypothetical protein | - |
| MOO21_RS23610 (45056) | 45056..45288 | + | 233 | Protein_53 | hypothetical protein | - |
| MOO21_RS23615 (45353) | 45353..45529 | - | 177 | WP_001054901.1 | hypothetical protein | - |
| MOO21_RS23620 (45861) | 45861..46070 | + | 210 | WP_000062602.1 | HEAT repeat domain-containing protein | - |
| MOO21_RS23625 (46142) | 46142..46804 | - | 663 | WP_060527638.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| MOO21_RS23630 (46875) | 46875..49043 | - | 2169 | WP_000698368.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..88459 | 88459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5809.14 Da Isoelectric Point: 8.7948
>T252183 WP_023156060.1 NZ_CP101515:44219-44371 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT252183 NZ_CP101515:c44164-44107 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
