Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 732218..732911 | Replicon | chromosome |
| Accession | NZ_CP101513 | ||
| Organism | Escherichia coli strain HH194M | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | MOO21_RS03560 | Protein ID | WP_000415584.1 |
| Coordinates | 732218..732514 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | MOO21_RS03565 | Protein ID | WP_000650107.1 |
| Coordinates | 732516..732911 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MOO21_RS03525 (727306) | 727306..727620 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
| MOO21_RS03530 (727651) | 727651..728232 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| MOO21_RS03535 (728551) | 728551..728883 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
| MOO21_RS03540 (728929) | 728929..730278 | - | 1350 | WP_001618857.1 | quorum sensing histidine kinase QseC | - |
| MOO21_RS03545 (730275) | 730275..730934 | - | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| MOO21_RS03550 (731086) | 731086..731478 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| MOO21_RS03555 (731531) | 731531..732013 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| MOO21_RS03560 (732218) | 732218..732514 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| MOO21_RS03565 (732516) | 732516..732911 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| MOO21_RS03570 (733044) | 733044..734651 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| MOO21_RS03575 (734789) | 734789..737047 | + | 2259 | WP_049253102.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T252165 WP_000415584.1 NZ_CP101513:732218-732514 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT252165 WP_000650107.1 NZ_CP101513:732516-732911 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|