Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 667646..668373 | Replicon | chromosome |
Accession | NZ_CP101513 | ||
Organism | Escherichia coli strain HH194M |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | MOO21_RS03255 | Protein ID | WP_000550189.1 |
Coordinates | 667646..667960 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | MOO21_RS03260 | Protein ID | WP_000560266.1 |
Coordinates | 667957..668373 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MOO21_RS03235 (663813) | 663813..664799 | - | 987 | WP_023281494.1 | Gfo/Idh/MocA family oxidoreductase | - |
MOO21_RS03240 (664878) | 664878..665561 | - | 684 | WP_001183042.1 | vancomycin high temperature exclusion protein | - |
MOO21_RS03245 (665638) | 665638..666141 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
MOO21_RS03250 (666226) | 666226..667362 | + | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
MOO21_RS03255 (667646) | 667646..667960 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
MOO21_RS03260 (667957) | 667957..668373 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
MOO21_RS03265 (668418) | 668418..670435 | - | 2018 | Protein_639 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
MOO21_RS03270 (670861) | 670861..673212 | - | 2352 | WP_024238710.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T252164 WP_000550189.1 NZ_CP101513:667646-667960 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT252164 WP_000560266.1 NZ_CP101513:667957-668373 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|