Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 989346..989605 | Replicon | chromosome |
| Accession | NZ_CP101472 | ||
| Organism | Staphylococcus equorum strain DX2 | ||
Toxin (Protein)
| Gene name | SprG2 | Uniprot ID | - |
| Locus tag | NMQ06_RS04690 | Protein ID | WP_002511402.1 |
| Coordinates | 989346..989453 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 989443..989605 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMQ06_RS04660 (NMQ06_04655) | 984578..985450 | + | 873 | WP_002507156.1 | ABC transporter ATP-binding protein | - |
| NMQ06_RS04665 (NMQ06_04660) | 985450..986178 | + | 729 | WP_002507157.1 | ABC transporter permease subunit | - |
| NMQ06_RS04670 (NMQ06_04665) | 986261..986821 | - | 561 | WP_002507158.1 | thioredoxin family protein | - |
| NMQ06_RS04675 (NMQ06_04670) | 987037..987477 | + | 441 | WP_231111012.1 | hypothetical protein | - |
| NMQ06_RS04680 (NMQ06_04675) | 987572..988132 | + | 561 | WP_002511403.1 | DUF1700 domain-containing protein | - |
| NMQ06_RS04685 (NMQ06_04680) | 988129..988980 | + | 852 | WP_021339982.1 | DUF4097 family beta strand repeat-containing protein | - |
| NMQ06_RS04690 (NMQ06_04685) | 989346..989453 | + | 108 | WP_002511402.1 | putative holin-like toxin | Toxin |
| - | 989443..989605 | - | 163 | - | - | Antitoxin |
| NMQ06_RS04695 (NMQ06_04690) | 989741..989911 | - | 171 | WP_255157135.1 | hypothetical protein | - |
| NMQ06_RS04700 (NMQ06_04695) | 990219..991259 | - | 1041 | WP_021339984.1 | C45 family autoproteolytic acyltransferase/hydolase | - |
| NMQ06_RS04705 (NMQ06_04700) | 991754..991924 | + | 171 | WP_002507168.1 | hypothetical protein | - |
| NMQ06_RS04710 | 992028..992150 | + | 123 | WP_255157137.1 | hypothetical protein | - |
| NMQ06_RS04715 (NMQ06_04705) | 992143..992322 | + | 180 | WP_064782806.1 | hypothetical protein | - |
| NMQ06_RS04720 (NMQ06_04710) | 992377..992787 | - | 411 | WP_002507169.1 | YolD-like family protein | - |
| NMQ06_RS04725 (NMQ06_04715) | 992964..994001 | + | 1038 | WP_021339833.1 | lactonase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3756.72 Da Isoelectric Point: 10.4997
>T252155 WP_002511402.1 NZ_CP101472:989346-989453 [Staphylococcus equorum]
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
VVPIVEALHLMLGFGTFIVTLLGLVVAIVKLSHKK
Download Length: 108 bp
Antitoxin
Download Length: 163 bp
>AT252155 NZ_CP101472:c989605-989443 [Staphylococcus equorum]
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
ATTTGATAATATTTTTATGTTGTGGTAATTTATATATAGAAAAAGGGCAACACACCATAAGTGTATCGCCCTAATGAGCC
CGTTAAAAAGACGGTGGCTGGAATTTAATAATGATTAAATAATCATCTCATCCTCGCCAAAGTTAGAGATGGTTATTTTT
TAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|