Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 3820972..3821565 | Replicon | chromosome |
| Accession | NZ_CP101417 | ||
| Organism | Xanthomonas hortorum strain jj2001 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V7ZC95 |
| Locus tag | NMB96_RS16350 | Protein ID | WP_023903907.1 |
| Coordinates | 3820972..3821256 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMB96_RS16355 | Protein ID | WP_023903908.1 |
| Coordinates | 3821266..3821565 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMB96_RS16325 (NMB96_16310) | 3816157..3816465 | - | 309 | WP_023903904.1 | STAS domain-containing protein | - |
| NMB96_RS16330 (NMB96_16315) | 3816569..3817819 | - | 1251 | WP_023903905.1 | chemotaxis protein CheW | - |
| NMB96_RS16335 (NMB96_16320) | 3817816..3818598 | - | 783 | WP_006452730.1 | ParA family protein | - |
| NMB96_RS16340 (NMB96_16325) | 3818600..3819574 | - | 975 | WP_023903906.1 | flagellar motor protein MotD | - |
| NMB96_RS16345 (NMB96_16330) | 3819582..3820322 | - | 741 | WP_006452732.1 | flagellar motor protein | - |
| NMB96_RS16350 (NMB96_16335) | 3820972..3821256 | + | 285 | WP_023903907.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMB96_RS16355 (NMB96_16340) | 3821266..3821565 | + | 300 | WP_023903908.1 | HigA family addiction module antitoxin | Antitoxin |
| NMB96_RS16360 (NMB96_16345) | 3821715..3822425 | - | 711 | Protein_3199 | chemotaxis protein CheW | - |
| NMB96_RS16365 (NMB96_16350) | 3823126..3826281 | + | 3156 | WP_255085282.1 | TonB-dependent receptor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10724.18 Da Isoelectric Point: 7.9183
>T252145 WP_023903907.1 NZ_CP101417:3820972-3821256 [Xanthomonas hortorum]
MIQSFRCKHTRALFEGASPRQFRSMQAAAERKLQLLDSAQTLEFLRSPPGNRLELLAGTRAGQHSISISINDQWRVCFVW
TDAGPEHVEIVDYH
MIQSFRCKHTRALFEGASPRQFRSMQAAAERKLQLLDSAQTLEFLRSPPGNRLELLAGTRAGQHSISISINDQWRVCFVW
TDAGPEHVEIVDYH
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|