Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1506648..1507237 | Replicon | chromosome |
| Accession | NZ_CP101417 | ||
| Organism | Xanthomonas hortorum strain jj2001 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | V7Z6D6 |
| Locus tag | NMB96_RS06340 | Protein ID | WP_023905806.1 |
| Coordinates | 1506648..1506929 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMB96_RS06345 | Protein ID | WP_006449989.1 |
| Coordinates | 1506947..1507237 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMB96_RS06325 (NMB96_06310) | 1503253..1504233 | - | 981 | WP_183086757.1 | IS5 family transposase | - |
| NMB96_RS06330 (NMB96_06315) | 1504286..1505536 | - | 1251 | WP_043889786.1 | XopAP family type III secretion system effector | - |
| NMB96_RS06335 (NMB96_06320) | 1505601..1505885 | - | 285 | WP_104552355.1 | hypothetical protein | - |
| NMB96_RS06340 (NMB96_06325) | 1506648..1506929 | + | 282 | WP_023905806.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NMB96_RS06345 (NMB96_06330) | 1506947..1507237 | + | 291 | WP_006449989.1 | HigA family addiction module antitoxin | Antitoxin |
| NMB96_RS06350 (NMB96_06335) | 1507420..1507610 | - | 191 | Protein_1250 | hypothetical protein | - |
| NMB96_RS06355 (NMB96_06340) | 1507764..1508096 | - | 333 | WP_183086954.1 | hypothetical protein | - |
| NMB96_RS06360 (NMB96_06345) | 1508653..1509060 | + | 408 | WP_104592032.1 | hypothetical protein | - |
| NMB96_RS06365 (NMB96_06350) | 1509095..1510249 | + | 1155 | WP_023905258.1 | hypothetical protein | - |
| NMB96_RS06370 (NMB96_06355) | 1510364..1510696 | - | 333 | WP_255086512.1 | hypothetical protein | - |
| NMB96_RS06375 (NMB96_06360) | 1510823..1511569 | - | 747 | WP_255086513.1 | RelA/SpoT domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1494518..1536315 | 41797 | |
| - | flank | IS/Tn | - | - | 1503253..1504233 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11071.73 Da Isoelectric Point: 9.7972
>T252141 WP_023905806.1 NZ_CP101417:1506648-1506929 [Xanthomonas hortorum]
MIRSFVDKEAEKIWQGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWQGERSRRLPADIQPVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|