Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4783099..4783853 | Replicon | chromosome |
| Accession | NZ_CP101390 | ||
| Organism | Salmonella enterica strain SC2017297 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NMU39_RS23470 | Protein ID | WP_000558166.1 |
| Coordinates | 4783099..4783410 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU39_RS23475 | Protein ID | WP_001259011.1 |
| Coordinates | 4783407..4783853 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU39_RS23440 (4778757) | 4778757..4779659 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU39_RS23445 (4779656) | 4779656..4780291 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU39_RS23450 (4780288) | 4780288..4781217 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU39_RS23455 (4781264) | 4781264..4781554 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NMU39_RS23460 (4781555) | 4781555..4781866 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NMU39_RS23465 (4782084) | 4782084..4783013 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU39_RS23470 (4783099) | 4783099..4783410 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMU39_RS23475 (4783407) | 4783407..4783853 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NMU39_RS23480 (4783868) | 4783868..4784809 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU39_RS23485 (4784854) | 4784854..4785291 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU39_RS23490 (4785288) | 4785288..4786160 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU39_RS23495 (4786154) | 4786154..4786753 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NMU39_RS23500 (4786944) | 4786944..4787747 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NMU39_RS23505 (4787781) | 4787781..4788677 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252131 WP_000558166.1 NZ_CP101390:4783099-4783410 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252131 WP_001259011.1 NZ_CP101390:4783407-4783853 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|