Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4778411..4779165 | Replicon | chromosome |
| Accession | NZ_CP101386 | ||
| Organism | Salmonella enterica strain SC2017100 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NMU37_RS23435 | Protein ID | WP_000558166.1 |
| Coordinates | 4778411..4778722 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU37_RS23440 | Protein ID | WP_001259011.1 |
| Coordinates | 4778719..4779165 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU37_RS23405 (4774069) | 4774069..4774971 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU37_RS23410 (4774968) | 4774968..4775603 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU37_RS23415 (4775600) | 4775600..4776529 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU37_RS23420 (4776576) | 4776576..4776866 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NMU37_RS23425 (4776867) | 4776867..4777178 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NMU37_RS23430 (4777396) | 4777396..4778325 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU37_RS23435 (4778411) | 4778411..4778722 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMU37_RS23440 (4778719) | 4778719..4779165 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NMU37_RS23445 (4779180) | 4779180..4780121 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU37_RS23450 (4780166) | 4780166..4780603 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU37_RS23455 (4780600) | 4780600..4781472 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU37_RS23460 (4781466) | 4781466..4782065 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NMU37_RS23465 (4782256) | 4782256..4783059 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NMU37_RS23470 (4783093) | 4783093..4783989 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252091 WP_000558166.1 NZ_CP101386:4778411-4778722 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252091 WP_001259011.1 NZ_CP101386:4778719-4779165 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|