Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2521723..2522245 | Replicon | chromosome |
Accession | NZ_CP101386 | ||
Organism | Salmonella enterica strain SC2017100 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NMU37_RS12450 | Protein ID | WP_000221343.1 |
Coordinates | 2521961..2522245 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU37_RS12445 | Protein ID | WP_000885424.1 |
Coordinates | 2521723..2521971 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU37_RS12420 (2516939) | 2516939..2518405 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NMU37_RS12425 (2519213) | 2519213..2519927 | + | 715 | Protein_2432 | helix-turn-helix domain-containing protein | - |
NMU37_RS12430 (2519983) | 2519983..2520891 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NMU37_RS12435 (2521034) | 2521034..2521366 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NMU37_RS12440 (2521356) | 2521356..2521571 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NMU37_RS12445 (2521723) | 2521723..2521971 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU37_RS12450 (2521961) | 2521961..2522245 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU37_RS12455 (2522416) | 2522416..2522805 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU37_RS12460 (2522857) | 2522857..2523936 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU37_RS12465 (2524129) | 2524129..2524617 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU37_RS12470 (2524662) | 2524662..2526170 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2516942..2529027 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T252083 WP_000221343.1 NZ_CP101386:2521961-2522245 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |