Detailed information of TA system TA252050

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 117867..118293
• Replicon: plasmid pSC2016090-mcr-147k
• Accession: NZ_CP101380
• Organism: Salmonella enterica strain SC2016290

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NMU35_RS25360
• Protein ID: WP_001372321.1
• Coordinates: 117867..117992 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	118069..118293 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NMU35_RS25315 (112917)	112917..113144	-	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-
NMU35_RS25320 (113238)	113238..113924	-	687	WP_000332484.1	PAS domain-containing protein	-
NMU35_RS25325 (114115)	114115..114498	-	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NMU35_RS25330 (114775)	114775..115422	+	648	WP_031943493.1	transglycosylase SLT domain-containing protein	-
NMU35_RS25335 (115719)	115719..116540	-	822	WP_001234469.1	DUF932 domain-containing protein	-
NMU35_RS25340 (116658)	116658..116945	-	288	WP_000107544.1	hypothetical protein	-
NMU35_RS25345 (116970)	116970..117176	-	207	WP_000547968.1	hypothetical protein	-
NMU35_RS25350 (117246)	117246..117419	+	174	Protein_152	hypothetical protein	-
NMU35_RS25355 (117417)	117417..117647	-	231	WP_001426396.1	hypothetical protein	-
NMU35_RS25360 (117867)	117867..117992	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NMU35_RS25365 (117934)	117934..118083	-	150	Protein_155	plasmid maintenance protein Mok	-
- (118071)	118071..118136	-	66	NuclAT_1	-	-
- (118069)	118069..118293	+	225	NuclAT_0	-	-
- (118069)	118069..118293	-	225	NuclAT_0	-	Antitoxin
- (118069)	118069..118293	-	225	NuclAT_0	-	Antitoxin
- (118069)	118069..118293	-	225	NuclAT_0	-	Antitoxin
- (118069)	118069..118293	-	225	NuclAT_0	-	Antitoxin
NMU35_RS25370 (118305)	118305..119024	-	720	WP_013362833.1	plasmid SOS inhibition protein A	-
NMU35_RS25375 (119021)	119021..119455	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NMU35_RS25380 (119510)	119510..120706	-	1197	Protein_158	hypothetical protein	-
NMU35_RS25385 (120740)	120740..121561	-	822	WP_039026397.1	IS3 family transposase	-
NMU35_RS25390 (121558)	121558..121872	-	315	WP_039026396.1	transposase	-
NMU35_RS25395 (122067)	122067..122447	-	381	WP_039026395.1	diacylglycerol kinase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	floR / tet(A) / aph(6)-Id / sul2 / catA2 / blaCTX-M-55 / blaTEM-1B / mcr-3.1	-	1..147496	147496

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252050 WP_001372321.1 NZ_CP101380:c117992-117867 [Salmonella enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT252050 NZ_CP101380:c118293-118069 [Salmonella enterica]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin