252049

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 13609..14266 Replicon plasmid pSC2016090-mcr-147k
Accession NZ_CP101380
Organism Salmonella enterica strain SC2016290

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag NMU35_RS24700 Protein ID WP_000270043.1
Coordinates 13916..14266 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NMU35_RS24695 Protein ID WP_000124640.1
Coordinates 13609..13911 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU35_RS24650 (9234) 9234..9662 + 429 WP_000591074.1 hypothetical protein -
NMU35_RS24655 (9719) 9719..10078 + 360 WP_000422768.1 hypothetical protein -
NMU35_RS24660 (10078) 10078..10524 + 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
NMU35_RS24665 (10521) 10521..11039 + 519 WP_000210756.1 nitrite reductase -
NMU35_RS24670 (11039) 11039..11269 + 231 WP_000972663.1 hypothetical protein -
NMU35_RS24675 (11256) 11256..12113 + 858 WP_001167032.1 hypothetical protein -
NMU35_RS24680 (12344) 12344..12871 + 528 WP_001236377.1 thermonuclease family protein -
NMU35_RS24685 (12929) 12929..13201 + 273 WP_001043047.1 HU family DNA-binding protein -
NMU35_RS24690 (13289) 13289..13582 + 294 WP_001239997.1 chromosome segregation protein ParM -
NMU35_RS24695 (13609) 13609..13911 - 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
NMU35_RS24700 (13916) 13916..14266 - 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NMU35_RS24705 (14429) 14429..14977 + 549 WP_001061574.1 transcriptional regulator -
NMU35_RS24710 (15318) 15318..15512 + 195 WP_000343597.1 hypothetical protein -
NMU35_RS24715 (15523) 15523..15894 + 372 WP_000516916.1 hypothetical protein -
NMU35_RS24720 (15887) 15887..16357 + 471 WP_001281821.1 hypothetical protein -
NMU35_RS24725 (16372) 16372..16707 - 336 WP_000683476.1 hypothetical protein -
NMU35_RS24730 (16804) 16804..17292 + 489 WP_001273096.1 DUF1643 domain-containing protein -
NMU35_RS24735 (17295) 17295..17792 + 498 WP_000062185.1 hypothetical protein -
NMU35_RS24740 (18007) 18007..18711 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
NMU35_RS24745 (18776) 18776..18955 - 180 Protein_31 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / aph(6)-Id / sul2 / catA2 / blaCTX-M-55 / blaTEM-1B / mcr-3.1 - 1..147496 147496


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T252049 WP_000270043.1 NZ_CP101380:c14266-13916 [Salmonella enterica]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT252049 WP_000124640.1 NZ_CP101380:c13911-13609 [Salmonella enterica]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References