Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4802601..4803355 | Replicon | chromosome |
| Accession | NZ_CP101379 | ||
| Organism | Salmonella enterica strain SC2016290 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NMU35_RS23605 | Protein ID | WP_000558166.1 |
| Coordinates | 4802601..4802912 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU35_RS23610 | Protein ID | WP_001259011.1 |
| Coordinates | 4802909..4803355 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU35_RS23575 (4798259) | 4798259..4799161 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU35_RS23580 (4799158) | 4799158..4799793 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU35_RS23585 (4799790) | 4799790..4800719 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU35_RS23590 (4800766) | 4800766..4801056 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NMU35_RS23595 (4801057) | 4801057..4801368 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NMU35_RS23600 (4801586) | 4801586..4802515 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU35_RS23605 (4802601) | 4802601..4802912 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMU35_RS23610 (4802909) | 4802909..4803355 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NMU35_RS23615 (4803370) | 4803370..4804311 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU35_RS23620 (4804356) | 4804356..4804793 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU35_RS23625 (4804790) | 4804790..4805662 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU35_RS23630 (4805656) | 4805656..4806255 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NMU35_RS23635 (4806446) | 4806446..4807249 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NMU35_RS23640 (4807283) | 4807283..4808179 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T252048 WP_000558166.1 NZ_CP101379:4802601-4802912 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT252048 WP_001259011.1 NZ_CP101379:4802909-4803355 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|