Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2464789..2465311 | Replicon | chromosome |
Accession | NZ_CP101379 | ||
Organism | Salmonella enterica strain SC2016290 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NMU35_RS12165 | Protein ID | WP_000221343.1 |
Coordinates | 2465027..2465311 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU35_RS12160 | Protein ID | WP_000885424.1 |
Coordinates | 2464789..2465037 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU35_RS12135 (2460005) | 2460005..2461471 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NMU35_RS12140 (2462279) | 2462279..2462993 | + | 715 | Protein_2375 | helix-turn-helix domain-containing protein | - |
NMU35_RS12145 (2463049) | 2463049..2463957 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NMU35_RS12150 (2464100) | 2464100..2464432 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NMU35_RS12155 (2464422) | 2464422..2464637 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NMU35_RS12160 (2464789) | 2464789..2465037 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU35_RS12165 (2465027) | 2465027..2465311 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU35_RS12170 (2465482) | 2465482..2465871 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU35_RS12175 (2465923) | 2465923..2467002 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU35_RS12180 (2467195) | 2467195..2467683 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU35_RS12185 (2467728) | 2467728..2469236 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2460008..2478061 | 18053 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T252040 WP_000221343.1 NZ_CP101379:2465027-2465311 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |