Detailed information of TA system TA252026

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 74870..75296
• Replicon: plasmid pSC2016091-mcr-116k
• Accession: NZ_CP101378
• Organism: Salmonella enterica strain SC2016091

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: NMU34_RS24995
• Protein ID: WP_001372321.1
• Coordinates: 74870..74995 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	75072..75296 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NMU34_RS24955 (70239)	70239..70928	-	690	WP_039002187.1	conjugal transfer transcriptional regulator TraJ	-
NMU34_RS24960 (71115)	71115..71498	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
NMU34_RS24965 (71819)	71819..72421	+	603	WP_097738799.1	transglycosylase SLT domain-containing protein	-
NMU34_RS24970 (72718)	72718..73539	-	822	WP_072795862.1	DUF932 domain-containing protein	-
NMU34_RS24975 (73661)	73661..73948	-	288	WP_000107535.1	hypothetical protein	-
NMU34_RS24980 (73973)	73973..74179	-	207	WP_000275859.1	hypothetical protein	-
NMU34_RS24985 (74249)	74249..74422	+	174	Protein_83	hypothetical protein	-
NMU34_RS24990 (74420)	74420..74650	-	231	WP_001426396.1	hypothetical protein	-
NMU34_RS24995 (74870)	74870..74995	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
NMU34_RS25000 (74937)	74937..75086	-	150	Protein_86	plasmid maintenance protein Mok	-
- (75072)	75072..75296	-	225	NuclAT_0	-	Antitoxin
- (75072)	75072..75296	-	225	NuclAT_0	-	Antitoxin
- (75072)	75072..75296	-	225	NuclAT_0	-	Antitoxin
- (75072)	75072..75296	-	225	NuclAT_0	-	Antitoxin
NMU34_RS25005 (75308)	75308..76027	-	720	WP_013362833.1	plasmid SOS inhibition protein A	-
NMU34_RS25010 (76024)	76024..76458	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
NMU34_RS25015 (76513)	76513..78471	-	1959	WP_255223149.1	ParB/RepB/Spo0J family partition protein	-
NMU34_RS25020 (78537)	78537..78770	-	234	WP_000005990.1	DUF905 family protein	-
NMU34_RS25025 (78833)	78833..79372	-	540	WP_001825195.1	single-stranded DNA-binding protein	-
NMU34_RS25030 (79398)	79398..79604	-	207	WP_000275858.1	hypothetical protein	-
NMU34_RS25035 (79845)	79845..80117	-	273	WP_072118979.1	hypothetical protein	-
NMU34_RS25040 (80015)	80015..80242	-	228	WP_001825119.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaCTX-M-55 / qnrS1 / mcr-3.1 / aac(3)-IId	-	1..116686	116686

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T252026 WP_001372321.1 NZ_CP101378:c74995-74870 [Salmonella enterica]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT252026 NZ_CP101378:c75296-75072 [Salmonella enterica]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin