Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4802625..4803227 | Replicon | chromosome |
Accession | NZ_CP101376 | ||
Organism | Salmonella enterica strain SC2016091 |
Toxin (Protein)
Gene name | higB | Uniprot ID | C0Q3J8 |
Locus tag | NMU34_RS23560 | Protein ID | WP_001159630.1 |
Coordinates | 4802916..4803227 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NMU34_RS23555 | Protein ID | WP_000362050.1 |
Coordinates | 4802625..4802915 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU34_RS23540 (4800118) | 4800118..4801020 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
NMU34_RS23545 (4801017) | 4801017..4801652 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
NMU34_RS23550 (4801649) | 4801649..4802578 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
NMU34_RS23555 (4802625) | 4802625..4802915 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
NMU34_RS23560 (4802916) | 4802916..4803227 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
NMU34_RS23565 (4803445) | 4803445..4804374 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
NMU34_RS23570 (4804460) | 4804460..4804771 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
NMU34_RS23575 (4804768) | 4804768..4805214 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
NMU34_RS23580 (4805229) | 4805229..4806170 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
NMU34_RS23585 (4806215) | 4806215..4806652 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
NMU34_RS23590 (4806649) | 4806649..4807521 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
NMU34_RS23595 (4807515) | 4807515..4808114 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T252024 WP_001159630.1 NZ_CP101376:c4803227-4802916 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|