Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 3105644..3106166 | Replicon | chromosome |
Accession | NZ_CP101375 | ||
Organism | Salmonella enterica strain SC2016090 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NMU33_RS15370 | Protein ID | WP_000221343.1 |
Coordinates | 3105882..3106166 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU33_RS15365 | Protein ID | WP_000885424.1 |
Coordinates | 3105644..3105892 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU33_RS15340 (3100860) | 3100860..3102326 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NMU33_RS15345 (3103134) | 3103134..3103848 | + | 715 | Protein_2997 | helix-turn-helix domain-containing protein | - |
NMU33_RS15350 (3103904) | 3103904..3104812 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NMU33_RS15355 (3104955) | 3104955..3105287 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NMU33_RS15360 (3105277) | 3105277..3105492 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NMU33_RS15365 (3105644) | 3105644..3105892 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU33_RS15370 (3105882) | 3105882..3106166 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU33_RS15375 (3106337) | 3106337..3106726 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU33_RS15380 (3106778) | 3106778..3107857 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU33_RS15385 (3108050) | 3108050..3108538 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU33_RS15390 (3108583) | 3108583..3110091 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3100863..3112948 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T252000 WP_000221343.1 NZ_CP101375:3105882-3106166 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |