Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 115820..116574 | Replicon | chromosome |
| Accession | NZ_CP101375 | ||
| Organism | Salmonella enterica strain SC2016090 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NMU33_RS00530 | Protein ID | WP_000558166.1 |
| Coordinates | 115820..116131 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU33_RS00535 | Protein ID | WP_001259011.1 |
| Coordinates | 116128..116574 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU33_RS00500 (111478) | 111478..112380 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU33_RS00505 (112377) | 112377..113012 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU33_RS00510 (113009) | 113009..113938 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU33_RS00515 (113985) | 113985..114275 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NMU33_RS00520 (114276) | 114276..114587 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NMU33_RS00525 (114805) | 114805..115734 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU33_RS00530 (115820) | 115820..116131 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMU33_RS00535 (116128) | 116128..116574 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NMU33_RS00540 (116589) | 116589..117530 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU33_RS00545 (117575) | 117575..118012 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU33_RS00550 (118009) | 118009..118881 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU33_RS00555 (118875) | 118875..119474 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NMU33_RS00560 (119665) | 119665..120468 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NMU33_RS00565 (120502) | 120502..121398 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251988 WP_000558166.1 NZ_CP101375:115820-116131 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251988 WP_001259011.1 NZ_CP101375:116128-116574 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|