Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4755768..4756522 | Replicon | chromosome |
| Accession | NZ_CP101373 | ||
| Organism | Salmonella enterica strain SC2016042 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | NMU32_RS23305 | Protein ID | WP_000558166.1 |
| Coordinates | 4755768..4756079 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU32_RS23310 | Protein ID | WP_001259011.1 |
| Coordinates | 4756076..4756522 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU32_RS23275 (4751426) | 4751426..4752328 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU32_RS23280 (4752325) | 4752325..4752960 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU32_RS23285 (4752957) | 4752957..4753886 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU32_RS23290 (4753933) | 4753933..4754223 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| NMU32_RS23295 (4754224) | 4754224..4754535 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| NMU32_RS23300 (4754753) | 4754753..4755682 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU32_RS23305 (4755768) | 4755768..4756079 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| NMU32_RS23310 (4756076) | 4756076..4756522 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| NMU32_RS23315 (4756537) | 4756537..4757478 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU32_RS23320 (4757523) | 4757523..4757960 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU32_RS23325 (4757957) | 4757957..4758829 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU32_RS23330 (4758823) | 4758823..4759422 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| NMU32_RS23335 (4759613) | 4759613..4760416 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| NMU32_RS23340 (4760450) | 4760450..4761346 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T251984 WP_000558166.1 NZ_CP101373:4755768-4756079 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT251984 WP_001259011.1 NZ_CP101373:4756076-4756522 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|