Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2502373..2502895 | Replicon | chromosome |
Accession | NZ_CP101373 | ||
Organism | Salmonella enterica strain SC2016042 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NMU32_RS12335 | Protein ID | WP_000221343.1 |
Coordinates | 2502611..2502895 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU32_RS12330 | Protein ID | WP_000885424.1 |
Coordinates | 2502373..2502621 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU32_RS12305 (2497589) | 2497589..2499055 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NMU32_RS12310 (2499863) | 2499863..2500577 | + | 715 | Protein_2409 | helix-turn-helix domain-containing protein | - |
NMU32_RS12315 (2500633) | 2500633..2501541 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NMU32_RS12320 (2501684) | 2501684..2502016 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NMU32_RS12325 (2502006) | 2502006..2502221 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NMU32_RS12330 (2502373) | 2502373..2502621 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU32_RS12335 (2502611) | 2502611..2502895 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU32_RS12340 (2503066) | 2503066..2503455 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU32_RS12345 (2503507) | 2503507..2504586 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU32_RS12350 (2504779) | 2504779..2505267 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU32_RS12355 (2505312) | 2505312..2506820 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2497592..2509677 | 12085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251976 WP_000221343.1 NZ_CP101373:2502611-2502895 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |