Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5048067..5048669 | Replicon | chromosome |
| Accession | NZ_CP101372 | ||
| Organism | Salmonella enterica strain SC2016025 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | C0Q3J8 |
| Locus tag | NMU31_RS24860 | Protein ID | WP_001159630.1 |
| Coordinates | 5048358..5048669 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMU31_RS24855 | Protein ID | WP_000362050.1 |
| Coordinates | 5048067..5048357 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMU31_RS24840 (5045560) | 5045560..5046462 | + | 903 | WP_000331361.1 | formate dehydrogenase subunit beta | - |
| NMU31_RS24845 (5046459) | 5046459..5047094 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMU31_RS24850 (5047091) | 5047091..5048020 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| NMU31_RS24855 (5048067) | 5048067..5048357 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | Antitoxin |
| NMU31_RS24860 (5048358) | 5048358..5048669 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | Toxin |
| NMU31_RS24865 (5048887) | 5048887..5049816 | + | 930 | WP_001127703.1 | alpha/beta hydrolase | - |
| NMU31_RS24870 (5049902) | 5049902..5050213 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | - |
| NMU31_RS24875 (5050210) | 5050210..5050656 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| NMU31_RS24880 (5050671) | 5050671..5051612 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| NMU31_RS24885 (5051657) | 5051657..5052094 | - | 438 | WP_000560974.1 | D-aminoacyl-tRNA deacylase | - |
| NMU31_RS24890 (5052091) | 5052091..5052963 | - | 873 | WP_000921427.1 | virulence factor BrkB family protein | - |
| NMU31_RS24895 (5052957) | 5052957..5053556 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12326.27 Da Isoelectric Point: 9.4460
>T251964 WP_001159630.1 NZ_CP101372:c5048669-5048358 [Salmonella enterica]
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
MQFIETELFTEDVKKLLDDDEYHKLQVFMAQHPDCGDVIQETGGLRKMRWGARGKGKRSGVRIIYFHRSQRYEIRLLLIY
QKGIKDDLTPQEKAVLRMLNERW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|