Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2794387..2794909 | Replicon | chromosome |
Accession | NZ_CP101372 | ||
Organism | Salmonella enterica strain SC2016025 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | NMU31_RS13890 | Protein ID | WP_000221343.1 |
Coordinates | 2794625..2794909 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | V1H457 |
Locus tag | NMU31_RS13885 | Protein ID | WP_000885424.1 |
Coordinates | 2794387..2794635 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU31_RS13860 (2789603) | 2789603..2791069 | + | 1467 | WP_000987828.1 | hypothetical protein | - |
NMU31_RS13865 (2791877) | 2791877..2792591 | + | 715 | Protein_2720 | helix-turn-helix domain-containing protein | - |
NMU31_RS13870 (2792647) | 2792647..2793555 | - | 909 | WP_010989018.1 | hypothetical protein | - |
NMU31_RS13875 (2793698) | 2793698..2794030 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
NMU31_RS13880 (2794020) | 2794020..2794235 | - | 216 | WP_000206207.1 | hypothetical protein | - |
NMU31_RS13885 (2794387) | 2794387..2794635 | + | 249 | WP_000885424.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NMU31_RS13890 (2794625) | 2794625..2794909 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NMU31_RS13895 (2795080) | 2795080..2795469 | + | 390 | WP_000194089.1 | RidA family protein | - |
NMU31_RS13900 (2795521) | 2795521..2796600 | - | 1080 | WP_000954688.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
NMU31_RS13905 (2796793) | 2796793..2797281 | - | 489 | WP_001293638.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
NMU31_RS13910 (2797326) | 2797326..2798834 | + | 1509 | WP_000199411.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 2791351..2801691 | 10340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T251957 WP_000221343.1 NZ_CP101372:2794625-2794909 [Salmonella enterica]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0WPN5 |