Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 44610..44874 Replicon plasmid pSC2014238-90k
Accession NZ_CP101371
Organism Salmonella enterica strain SC2014238

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag NMU30_RS24695 Protein ID WP_001387489.1
Coordinates 44610..44762 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 44814..44874 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU30_RS24665 (39876) 39876..42044 + 2169 WP_015508354.1 DotA/TraY family protein -
NMU30_RS24670 (42115) 42115..42777 + 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
NMU30_RS24675 (42849) 42849..43058 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
NMU30_RS24680 (43450) 43450..43626 + 177 WP_001054900.1 hypothetical protein -
NMU30_RS24685 (43691) 43691..43987 - 297 WP_011264046.1 DinQ-like type I toxin DqlB -
NMU30_RS24690 (44287) 44287..44538 + 252 WP_001291964.1 hypothetical protein -
NMU30_RS24695 (44610) 44610..44762 - 153 WP_001387489.1 Hok/Gef family protein Toxin
- (44814) 44814..44874 + 61 NuclAT_0 - Antitoxin
- (44814) 44814..44874 + 61 NuclAT_0 - Antitoxin
- (44814) 44814..44874 + 61 NuclAT_0 - Antitoxin
- (44814) 44814..44874 + 61 NuclAT_0 - Antitoxin
NMU30_RS24700 (45083) 45083..46168 + 1086 WP_000080543.1 protein finQ -
- (46238) 46238..46295 + 58 NuclAT_1 - -
- (46238) 46238..46295 + 58 NuclAT_1 - -
- (46238) 46238..46295 + 58 NuclAT_1 - -
- (46238) 46238..46295 + 58 NuclAT_1 - -
NMU30_RS24705 (46475) 46475..47683 + 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
NMU30_RS24710 (47702) 47702..48772 + 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..90508 90508


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T251942 WP_001387489.1 NZ_CP101371:c44762-44610 [Salmonella enterica]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT251942 NZ_CP101371:44814-44874 [Salmonella enterica]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References