Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 4725860..4726614 Replicon chromosome
Accession NZ_CP101369
Organism Salmonella enterica strain SC2014238

Toxin (Protein)


Gene name higB Uniprot ID A0A8E7K0F6
Locus tag NMU30_RS23315 Protein ID WP_023216604.1
Coordinates 4725860..4726171 (+) Length 104 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag NMU30_RS23320 Protein ID WP_031618981.1
Coordinates 4726168..4726614 (+) Length 149 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NMU30_RS23285 (4721518) 4721518..4722420 + 903 WP_000331361.1 formate dehydrogenase subunit beta -
NMU30_RS23290 (4722417) 4722417..4723052 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
NMU30_RS23295 (4723049) 4723049..4723978 + 930 WP_000027730.1 formate dehydrogenase accessory protein FdhE -
NMU30_RS23300 (4724025) 4724025..4724315 - 291 WP_000362050.1 DNA-binding transcriptional regulator -
NMU30_RS23305 (4724316) 4724316..4724627 - 312 WP_001159632.1 cytotoxic translational repressor of toxin-antitoxin stability system -
NMU30_RS23310 (4724845) 4724845..4725774 + 930 WP_198889148.1 alpha/beta hydrolase -
NMU30_RS23315 (4725860) 4725860..4726171 + 312 WP_023216604.1 type II toxin-antitoxin system HigB family toxin Toxin
NMU30_RS23320 (4726168) 4726168..4726614 + 447 WP_031618981.1 type II toxin-antitoxin system HigA family antitoxin Antitoxin
NMU30_RS23325 (4726629) 4726629..4727570 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
NMU30_RS23330 (4727615) 4727615..4728052 - 438 WP_000560969.1 D-aminoacyl-tRNA deacylase -
NMU30_RS23335 (4728049) 4728049..4728918 - 870 WP_023203606.1 virulence factor BrkB family protein -
NMU30_RS23340 (4728912) 4728912..4729511 - 600 WP_000965695.1 glucose-1-phosphatase -
NMU30_RS23345 (4729702) 4729702..4730505 - 804 WP_000059693.1 DeoR/GlpR family DNA-binding transcription regulator -
NMU30_RS23350 (4730539) 4730539..4731435 - 897 WP_001520529.1 sugar kinase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, mRNA interferase HigB

(21-93)

Antitoxin

Cro/C1-type helix-turn-helix domain

(93-146)


Sequences

Toxin        


Download         Length: 104 a.a.        Molecular weight: 12432.36 Da        Isoelectric Point: 9.2106

>T251939 WP_023216604.1 NZ_CP101369:4725860-4726171 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDQWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE

Download         Length: 312 bp

Antitoxin


Download         Length: 149 a.a.        Molecular weight: 16733.10 Da        Isoelectric Point: 6.9807

>AT251939 WP_031618981.1 NZ_CP101369:4726168-4726614 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNNNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE

Download         Length: 447 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References