Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1946811..1947471 | Replicon | chromosome |
Accession | NZ_CP101365 | ||
Organism | Salmonella enterica strain SC2014107 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A623V7Z2 |
Locus tag | NM059_RS09415 | Protein ID | WP_000269842.1 |
Coordinates | 1946811..1947164 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NM059_RS09420 | Protein ID | WP_000533827.1 |
Coordinates | 1947169..1947471 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NM059_RS09390 (1942876) | 1942876..1943631 | + | 756 | WP_001089670.1 | multiubiquitin domain-containing protein | - |
NM059_RS09395 (1943606) | 1943606..1944790 | + | 1185 | WP_076741638.1 | ThiF family adenylyltransferase | - |
NM059_RS09400 (1944784) | 1944784..1945248 | + | 465 | WP_001660343.1 | DUF6527 family protein | - |
NM059_RS09405 (1945629) | 1945629..1946096 | + | 468 | WP_000201266.1 | hypothetical protein | - |
NM059_RS09410 (1946093) | 1946093..1946314 | + | 222 | WP_000813787.1 | helix-turn-helix transcriptional regulator | - |
NM059_RS09415 (1946811) | 1946811..1947164 | + | 354 | WP_000269842.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NM059_RS09420 (1947169) | 1947169..1947471 | + | 303 | WP_000533827.1 | XRE family transcriptional regulator | Antitoxin |
NM059_RS09425 (1947977) | 1947977..1948861 | + | 885 | WP_000511750.1 | integrase domain-containing protein | - |
NM059_RS09430 (1949730) | 1949730..1950992 | - | 1263 | WP_076741637.1 | integrase arm-type DNA-binding domain-containing protein | - |
NM059_RS09440 (1951330) | 1951330..1952127 | - | 798 | WP_000598920.1 | DgsA anti-repressor MtfA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1920777..1960147 | 39370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13476.36 Da Isoelectric Point: 9.9199
>T251904 WP_000269842.1 NZ_CP101365:1946811-1947164 [Salmonella enterica]
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
VWTIKTTDTFDRWFASLNDTNRVSVLAALLVLREKGPGLSRPYADTVRGSRYSNMKELRIQSRGEPIRAFFAFDPTRTGI
VLCAGNKVGNEKRFYDEMLPVADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|