Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1107946..1108673 | Replicon | chromosome |
Accession | NZ_CP101310 | ||
Organism | Escherichia coli strain 99-3311 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3YYE6 |
Locus tag | NMK62_RS05460 | Protein ID | WP_000547563.1 |
Coordinates | 1107946..1108257 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NMK62_RS05465 | Protein ID | WP_000126294.1 |
Coordinates | 1108254..1108673 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK62_RS05430 (1103091) | 1103091..1104800 | + | 1710 | WP_001288147.1 | formate hydrogenlyase subunit HycE | - |
NMK62_RS05435 (1104810) | 1104810..1105352 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
NMK62_RS05440 (1105352) | 1105352..1106119 | + | 768 | WP_000067400.1 | formate hydrogenlyase subunit HycG | - |
NMK62_RS05445 (1106116) | 1106116..1106526 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
NMK62_RS05450 (1106519) | 1106519..1106986 | + | 468 | WP_000132960.1 | hydrogenase maturation peptidase HycI | - |
NMK62_RS05455 (1107029) | 1107029..1107784 | + | 756 | WP_001400787.1 | hypothetical protein | - |
NMK62_RS05460 (1107946) | 1107946..1108257 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
NMK62_RS05465 (1108254) | 1108254..1108673 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
NMK62_RS05470 (1108787) | 1108787..1110211 | - | 1425 | WP_000110310.1 | 6-phospho-beta-glucosidase AscB | - |
NMK62_RS05475 (1110220) | 1110220..1111677 | - | 1458 | WP_001107816.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
NMK62_RS05480 (1111938) | 1111938..1112948 | + | 1011 | WP_032161993.1 | DNA-binding transcriptional regulator AscG | - |
NMK62_RS05485 (1113097) | 1113097..1113624 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T251886 WP_000547563.1 NZ_CP101310:1107946-1108257 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT251886 WP_000126294.1 NZ_CP101310:1108254-1108673 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|