Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 746429..747122 | Replicon | chromosome |
Accession | NZ_CP101310 | ||
Organism | Escherichia coli strain 99-3311 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | NMK62_RS03750 | Protein ID | WP_000415584.1 |
Coordinates | 746429..746725 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | NMK62_RS03755 | Protein ID | WP_000650107.1 |
Coordinates | 746727..747122 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK62_RS03715 (741478) | 741478..741792 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
NMK62_RS03720 (741823) | 741823..742404 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
NMK62_RS03725 (742762) | 742762..743058 | + | 297 | WP_000912118.1 | DUF2645 family protein | - |
NMK62_RS03730 (743140) | 743140..744489 | - | 1350 | WP_000673396.1 | quorum sensing histidine kinase QseC | - |
NMK62_RS03735 (744486) | 744486..745145 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
NMK62_RS03740 (745297) | 745297..745689 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
NMK62_RS03745 (745742) | 745742..746224 | + | 483 | WP_000183497.1 | GyrI-like domain-containing protein | - |
NMK62_RS03750 (746429) | 746429..746725 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
NMK62_RS03755 (746727) | 746727..747122 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
NMK62_RS03760 (747255) | 747255..748862 | + | 1608 | WP_001400746.1 | ABC transporter substrate-binding protein | - |
NMK62_RS03765 (749000) | 749000..751258 | + | 2259 | WP_001281878.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T251883 WP_000415584.1 NZ_CP101310:746429-746725 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT251883 WP_000650107.1 NZ_CP101310:746727-747122 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|