Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 685376..686103 | Replicon | chromosome |
Accession | NZ_CP101310 | ||
Organism | Escherichia coli strain 99-3311 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | NMK62_RS03460 | Protein ID | WP_000550189.1 |
Coordinates | 685376..685690 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NMK62_RS03465 | Protein ID | WP_000560266.1 |
Coordinates | 685687..686103 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK62_RS03440 (681533) | 681533..682519 | - | 987 | WP_024221603.1 | Gfo/Idh/MocA family oxidoreductase | - |
NMK62_RS03445 (682598) | 682598..683290 | - | 693 | WP_000942541.1 | vancomycin high temperature exclusion protein | - |
NMK62_RS03450 (683367) | 683367..683870 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
NMK62_RS03455 (683955) | 683955..685091 | + | 1137 | WP_000018698.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
NMK62_RS03460 (685376) | 685376..685690 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
NMK62_RS03465 (685687) | 685687..686103 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
NMK62_RS03470 (686148) | 686148..688166 | - | 2019 | WP_000121443.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
NMK62_RS03475 (688470) | 688470..690014 | - | 1545 | WP_000258466.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T251882 WP_000550189.1 NZ_CP101310:685376-685690 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT251882 WP_000560266.1 NZ_CP101310:685687-686103 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|