Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 5189858..5190460 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | NMK57_RS26005 | Protein ID | WP_000897305.1 |
| Coordinates | 5190149..5190460 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMK57_RS26000 | Protein ID | WP_000356397.1 |
| Coordinates | 5189858..5190148 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS25975 (5185803) | 5185803..5186705 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| NMK57_RS25980 (5186702) | 5186702..5187337 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NMK57_RS25985 (5187334) | 5187334..5188263 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| NMK57_RS25990 (5188593) | 5188593..5188835 | - | 243 | WP_001086388.1 | protein YiiF | - |
| NMK57_RS25995 (5189054) | 5189054..5189272 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| NMK57_RS26000 (5189858) | 5189858..5190148 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| NMK57_RS26005 (5190149) | 5190149..5190460 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| NMK57_RS26010 (5190689) | 5190689..5191596 | + | 908 | Protein_5085 | alpha/beta hydrolase | - |
| NMK57_RS26015 (5191764) | 5191764..5192678 | - | 915 | WP_072097029.1 | transposase | - |
| NMK57_RS26020 (5192691) | 5192691..5193629 | - | 939 | Protein_5087 | hypothetical protein | - |
| NMK57_RS26025 (5193993) | 5193993..5194934 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| NMK57_RS26030 (5194979) | 5194979..5195416 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251877 WP_000897305.1 NZ_CP101305:c5190460-5190149 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|