Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 634423..635150 | Replicon | chromosome |
| Accession | NZ_CP101305 | ||
| Organism | Escherichia coli strain 2002-3211 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9ZMR4 |
| Locus tag | NMK57_RS03110 | Protein ID | WP_000550189.1 |
| Coordinates | 634423..634737 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | NMK57_RS03115 | Protein ID | WP_000560266.1 |
| Coordinates | 634734..635150 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMK57_RS03090 (630580) | 630580..631566 | - | 987 | WP_001297165.1 | Gfo/Idh/MocA family oxidoreductase | - |
| NMK57_RS03095 (631645) | 631645..632337 | - | 693 | WP_000942583.1 | vancomycin high temperature exclusion protein | - |
| NMK57_RS03100 (632414) | 632414..632917 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
| NMK57_RS03105 (633002) | 633002..634138 | + | 1137 | WP_000018685.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
| NMK57_RS03110 (634423) | 634423..634737 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
| NMK57_RS03115 (634734) | 634734..635150 | + | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
| NMK57_RS03120 (635195) | 635195..637213 | - | 2019 | WP_000121472.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
| NMK57_RS03125 (637539) | 637539..639890 | - | 2352 | WP_000695479.1 | alpha-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T251856 WP_000550189.1 NZ_CP101305:634423-634737 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT251856 WP_000560266.1 NZ_CP101305:634734-635150 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|