Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 5297819..5298421 | Replicon | chromosome |
Accession | NZ_CP101302 | ||
Organism | Escherichia coli strain 2000-3039 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | NMK59_RS26655 | Protein ID | WP_000897305.1 |
Coordinates | 5298110..5298421 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | NMK59_RS26650 | Protein ID | WP_000356397.1 |
Coordinates | 5297819..5298109 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMK59_RS26625 (5292894) | 5292894..5294501 | - | 1608 | WP_001222883.1 | dipeptide ABC transporter substrate-binding protein DppA | - |
NMK59_RS26630 (5294853) | 5294853..5295353 | - | 501 | WP_000469069.1 | hypothetical protein | - |
NMK59_RS26635 (5295345) | 5295345..5296325 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
NMK59_RS26640 (5296554) | 5296554..5296796 | - | 243 | WP_001086388.1 | protein YiiF | - |
NMK59_RS26645 (5297015) | 5297015..5297233 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
NMK59_RS26650 (5297819) | 5297819..5298109 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
NMK59_RS26655 (5298110) | 5298110..5298421 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
NMK59_RS26660 (5298650) | 5298650..5299558 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
NMK59_RS26665 (5299622) | 5299622..5300563 | - | 942 | WP_001300148.1 | fatty acid biosynthesis protein FabY | - |
NMK59_RS26670 (5300608) | 5300608..5301045 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
NMK59_RS26675 (5301042) | 5301042..5301914 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
NMK59_RS26680 (5301908) | 5301908..5302507 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
NMK59_RS26685 (5302606) | 5302606..5303391 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 5295345..5296325 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T251853 WP_000897305.1 NZ_CP101302:c5298421-5298110 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|